beta Actin antibody (Middle Region)

Catalog No. ABIN631092

The Rabbit Polyclonal anti-beta Actin antibody (ABIN631092) specifically detects beta Actin in WB. The antibody is reactive with Human, Mouse, Rat, Dog, Drosophila melanogaster and C. elegans samples.

Quick Overview for beta Actin antibody (Middle Region) (ABIN631092)

Target: beta Actin (ACTB) (Actin, beta (ACTB))

Reactivity: Human, Mouse, Rat, Dog, Drosophila melanogaster, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This beta Actin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-beta Actin Antibody

Binding Specificity: Middle Region

Specificity: Beta Actin antibody was raised against the middle region of ACTB

Purification: Affinity purified

Immunogen: beta Actin antibody was raised using the middle region of ACTB corresponding to a region with amino acids TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Actin Blocking Peptide, (ABIN5612316), is also available for use as a blocking control in assays to test for specificity of this Beta Actin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for beta Actin

Target: beta Actin (ACTB) (Actin, beta (ACTB))

Alternative Name: beta Actin

Background: This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Cell-Cell Junction Organization, Maintenance of Protein Location, Phototransduction