Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Lactamase, beta (LACTB) antibody

Antigen

Lactamase, beta (LACTB)

Synonyms G24, MRPL56, FLJ14902
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631100
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name Beta Lactamase
Immunogen Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE
Description LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.
Molecular Weight 41 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LACTB antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Metabolism, Enzymes
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Lactamase, beta (LACTB)", type "Antibodies"
Hosts Mouse (9), Rabbit (3)
Reactivities Escherichia Coli (E. Coli) (3), Human (2), Enterobacter (1)
Applications ELISA (9), Western Blotting (WB) (8), Enzyme Immunoassay (EIA) (2), Immunofluorescence (IF) (1)