Lactate Dehydrogenase C antibody (Middle Region)

Catalog No. ABIN631115

The Rabbit Polyclonal anti-Lactate Dehydrogenase C antibody is suitable to detect Lactate Dehydrogenase C in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for Lactate Dehydrogenase C antibody (Middle Region) (ABIN631115)

Target: Lactate Dehydrogenase C (LDHC)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lactate Dehydrogenase C antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Lactate Dehydrogenase C Antibody

Binding Specificity: Middle Region

Specificity: LDHC antibody was raised against the middle region of LDHC

Purification: Affinity purified

Immunogen: LDHC antibody was raised using the middle region of LDHC corresponding to a region with amino acids IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LDHC Blocking Peptide, (ABIN939588), is also available for use as a blocking control in assays to test for specificity of this LDHC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDHC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lactate Dehydrogenase C

Target: Lactate Dehydrogenase C (LDHC)

Alternative Name: LDHC

Background: Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Warburg Effect