PACRG antibody (Middle Region)

Catalog No. ABIN631123

This Rabbit Polyclonal antibody specifically detects PACRG in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PACRG antibody (Middle Region) (ABIN631123)

Target: PACRG (PARK2 Co-Regulated (PACRG))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PACRG antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PACRG Antibody

Binding Specificity: Middle Region

Specificity: PACRG antibody was raised against the middle region of PACRG

Purification: Affinity purified

Immunogen: PACRG antibody was raised using the middle region of PACRG corresponding to a region with amino acids GAIMARCNLDHLGSSDPPTSASQVAEIIVNSGDGIDYSQQKRENIGDLIQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PACRG Blocking Peptide, (ABIN938543), is also available for use as a blocking control in assays to test for specificity of this PACRG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PACRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PACRG

Target: PACRG (PARK2 Co-Regulated (PACRG))

Alternative Name: PACRG

Background: PACRG is a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson's disease. These genes are co-regulated in various tissues and they share a bi-directional promoter. Both genes are associated with susceptibility to leprosy.

Molecular Weight: 33 kDa (MW of target protein)