TKT antibody

Catalog No. ABIN631160

The Rabbit Polyclonal anti-TKT antibody is suitable to detect TKT in samples from Human, Rat and Mouse. It has been validated for WB.

Quick Overview for TKT antibody (ABIN631160)

Target: TKT (Transketolase (TKT))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TKT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TKT Antibody

Purification: Affinity purified

Immunogen: TKT antibody was raised using a synthetic peptide corresponding to a region with amino acids ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TKT Blocking Peptide, (ABIN938139), is also available for use as a blocking control in assays to test for specificity of this TKT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TKT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TKT

Target: TKT (Transketolase (TKT))

Alternative Name: TKT

Background: TKT belongs to the transketolase family. TKT has been implicated in the latent genetic disease Wernicke-Korsakoff syndrome (WKS), which causes specific brain damage.

Molecular Weight: 68 kDa (MW of target protein)