AGXT2L1 antibody (Middle Region)

Catalog No. ABIN631174

This Rabbit Polyclonal antibody specifically detects AGXT2L1 in WB. It exhibits reactivity toward Human.

Quick Overview for AGXT2L1 antibody (Middle Region) (ABIN631174)

Target: AGXT2L1 (Alanine-Glyoxylate Aminotransferase 2-Like 1 (AGXT2L1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGXT2L1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AGXT2L1 Antibody

Binding Specificity: Middle Region

Specificity: AGXT2 L1 antibody was raised against the middle region of AGXT2 1

Purification: Affinity purified

Immunogen: AGXT2 L1 antibody was raised using the middle region of AGXT2 1 corresponding to a region with amino acids KRVLLSADGPHRNVLKIKPPMCFTEEDAKFMVDQLDRILTVLEEAMGTKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AGXT2L1 Blocking Peptide, (ABIN940025), is also available for use as a blocking control in assays to test for specificity of this AGXT2L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGXT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGXT2L1

Target: AGXT2L1 (Alanine-Glyoxylate Aminotransferase 2-Like 1 (AGXT2L1))

Alternative Name: AGXT2L1

Background: AGXT2L1 belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.

Molecular Weight: 56 kDa (MW of target protein)