ABAT antibody (Middle Region)

Catalog No. ABIN631182

The Rabbit Polyclonal anti-ABAT antibody (ABIN631182) specifically detects ABAT in WB. The antibody is reactive with Human samples.

Quick Overview for ABAT antibody (Middle Region) (ABIN631182)

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABAT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABAT Antibody

Binding Specificity: Middle Region

Specificity: ABAT antibody was raised against the middle region of ABAT

Purification: Affinity purified

Immunogen: ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABAT Blocking Peptide, (ABIN936206), is also available for use as a blocking control in assays to test for specificity of this ABAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABAT

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Alternative Name: ABAT

Background: 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde.

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process