Mahogunin RING Finger Protein 1 antibody (Middle Region)

Catalog No. ABIN631214

The Rabbit Polyclonal anti-Mahogunin RING Finger Protein 1 antibody is suitable to detect Mahogunin RING Finger Protein 1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for Mahogunin RING Finger Protein 1 antibody (Middle Region) (ABIN631214)

Target: Mahogunin RING Finger Protein 1 (MGRN1) (Mahogunin, Ring Finger 1 (MGRN1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Mahogunin RING Finger Protein 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Mahogunin RING Finger Protein 1 Antibody

Binding Specificity: Middle Region

Specificity: MGRN1 antibody was raised against the middle region of MGRN1

Purification: Affinity purified

Immunogen: MGRN1 antibody was raised using the middle region of MGRN1 corresponding to a region with amino acids EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGRN1 Blocking Peptide, (ABIN937878), is also available for use as a blocking control in assays to test for specificity of this MGRN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGRN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Mahogunin RING Finger Protein 1

Target: Mahogunin RING Finger Protein 1 (MGRN1) (Mahogunin, Ring Finger 1 (MGRN1))

Alternative Name: MGRN1

Background: Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling