Ketohexokinase antibody

Catalog No. ABIN631256

The Rabbit Polyclonal anti-Ketohexokinase antibody is suitable to detect Ketohexokinase in samples from Human. It has been validated for WB.

Quick Overview for Ketohexokinase antibody (ABIN631256)

Target: Ketohexokinase (KHK)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ketohexokinase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Ketohexokinase Antibody

Purification: Affinity purified

Immunogen: KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHK Blocking Peptide, (ABIN938378), is also available for use as a blocking control in assays to test for specificity of this KHK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ketohexokinase

Target: Ketohexokinase (KHK)

Alternative Name: KHK

Background: KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.

Molecular Weight: 32 kDa (MW of target protein)