OCIAD1 antibody (C-Term)

Catalog No. ABIN631311

The Rabbit Polyclonal anti-OCIAD1 antibody (ABIN631311) specifically detects OCIAD1 in WB. The antibody is reactive with Human samples.

Quick Overview for OCIAD1 antibody (C-Term) (ABIN631311)

Target: OCIAD1 (OCIA Domain Containing 1 (OCIAD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OCIAD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OCIAD1 Antibody

Binding Specificity: C-Term

Specificity: OCIAD1 antibody was raised against the C terminal of OCIAD1

Purification: Affinity purified

Immunogen: OCIAD1 antibody was raised using the C terminal of OCIAD1 corresponding to a region with amino acids QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OCIAD1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this OCIAD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCIAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OCIAD1

Target: OCIAD1 (OCIA Domain Containing 1 (OCIAD1))

Alternative Name: OCIAD1

Background: OCIAD1 belongs to the OCIAD1 family. It contains 1 OCIA domain. OCIAD1 is over-expressed in metastatic ovarian cancer.

Molecular Weight: 27 kDa (MW of target protein)