CRABP2 antibody (Middle Region)

Catalog No. ABIN631322

The Rabbit Polyclonal anti-CRABP2 antibody is suitable to detect CRABP2 in samples from Human. It has been validated for WB.

Quick Overview for CRABP2 antibody (Middle Region) (ABIN631322)

Target: CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRABP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CRABP2 Antibody

Binding Specificity: Middle Region

Specificity: CRABP2 antibody was raised against the middle region of CRABP2

Purification: Affinity purified

Immunogen: CRABP2 antibody was raised using the middle region of CRABP2 corresponding to a region with amino acids FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRABP2 Blocking Peptide, (ABIN938263), is also available for use as a blocking control in assays to test for specificity of this CRABP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRABP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRABP2

Target: CRABP2 (Cellular Retinoic Acid Binding Protein 2 (CRABP2))

Alternative Name: CRABP2

Background: A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 geneuggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.

Molecular Weight: 16 kDa (MW of target protein)