PDZRN4 antibody (N-Term)

Catalog No. ABIN631326

The Rabbit Polyclonal anti-PDZRN4 antibody (ABIN631326) specifically detects PDZRN4 in WB. The antibody is reactive with Human samples.

Quick Overview for PDZRN4 antibody (N-Term) (ABIN631326)

Target: PDZRN4 (PDZ Domain Containing Ring Finger 4 (PDZRN4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDZRN4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDZRN4 Antibody

Binding Specificity: N-Term

Specificity: PDZRN4 antibody was raised against the N terminal of PDZRN4

Purification: Affinity purified

Immunogen: PDZRN4 antibody was raised using the N terminal of PDZRN4 corresponding to a region with amino acids SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDZRN4 Blocking Peptide, (ABIN5615303), is also available for use as a blocking control in assays to test for specificity of this PDZRN4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDZRN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDZRN4

Target: PDZRN4 (PDZ Domain Containing Ring Finger 4 (PDZRN4))

Alternative Name: PDZRN4

Background: The function of PDZRN4 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 89 kDa (MW of target protein)