CGR19 antibody (Middle Region)

Catalog No. ABIN631344

The Rabbit Polyclonal anti-CGR19 antibody (ABIN631344) specifically detects CGR19 in WB. The antibody is reactive with Human samples.

Quick Overview for CGR19 antibody (Middle Region) (ABIN631344)

Target: CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CGR19 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CGR19 Antibody

Binding Specificity: Middle Region

Specificity: CGRRF1 antibody was raised against the middle region of CGRRF1

Purification: Affinity purified

Immunogen: CGRRF1 antibody was raised using the middle region of CGRRF1 corresponding to a region with amino acids KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CGRRF1 Blocking Peptide, (ABIN939839), is also available for use as a blocking control in assays to test for specificity of this CGRRF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CGRRF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CGR19

Target: CGR19 (CGRRF1) (Cell Growth Regulator with Ring Finger Domain 1 (CGRRF1))

Alternative Name: CGRRF1

Background: CGRRF1 is able to inhibit growth in several cell lines.

Molecular Weight: 38 kDa (MW of target protein)