UBE4A antibody

Catalog No. ABIN631353

The Rabbit Polyclonal anti-UBE4A antibody (ABIN631353) specifically detects UBE4A in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for UBE4A antibody (ABIN631353)

Target: UBE4A (Ubiquitination Factor E4A (UBE4A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE4A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE4A Antibody

Purification: Affinity purified

Immunogen: UBE4 A antibody was raised using a synthetic peptide corresponding to a region with amino acids QYAPQLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE4A Blocking Peptide, (ABIN5616880), is also available for use as a blocking control in assays to test for specificity of this UBE4A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE4A

Target: UBE4A (Ubiquitination Factor E4A (UBE4A))

Alternative Name: UBE4A

Background: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE4A is an additional conjugation factor, E4, which is involved in multiubiquitin chain assembly.

Molecular Weight: 123 kDa (MW of target protein)