F-Box and WD Repeat Domain Containing 2 (FBXW2) antibody

Antigen: F-Box and WD Repeat Domain Containing 2 (FBXW2)

Synonyms: Md6, FBW2, Fwd2, MGC117371, MD6, 2700071L08Rik, fbxw2, MGC53244, FBXW2, md6, fbw2, fwd2

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN631359

Additional Information

Alternative name: FBXW2

Immunogen: FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI

Description: F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins.

Molecular Weight: 51 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXW2 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Restrictions: For Research Use only