alpha Actinin 4 antibody (C-Term)

Catalog No. ABIN631408

This Rabbit Polyclonal antibody specifically detects alpha Actinin 4 in WB. It exhibits reactivity toward Human.

Quick Overview for alpha Actinin 4 antibody (C-Term) (ABIN631408)

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This alpha Actinin 4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-alpha Actinin 4 Antibody

Binding Specificity: C-Term

Specificity: Alpha Actinin 4 antibody was raised against the C terminal of ACTN4

Purification: Affinity purified

Immunogen: alpha Actinin 4 antibody was raised using the C terminal of ACTN4 corresponding to a region with amino acids DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Alpha Actinin 4 Blocking Peptide, (ABIN937599), is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for alpha Actinin 4

Target: alpha Actinin 4 (ACTN4) (Actinin, alpha 4 (ACTN4))

Alternative Name: alpha Actinin 4

Background: Alpha actinins belong to the spectrin superfamily which is a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.

Molecular Weight: 105 kDa (MW of target protein)

Pathways: Proton Transport