CHN2 antibody

Catalog No. ABIN631409

The Rabbit Polyclonal anti-CHN2 antibody is suitable to detect CHN2 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for CHN2 antibody (ABIN631409)

Target: CHN2 (Chimerin (Chimaerin) 2 (CHN2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHN2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHN2 Antibody

Purification: Affinity purified

Immunogen: CHN2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHN2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CHN2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHN2

Target: CHN2 (Chimerin (Chimaerin) 2 (CHN2))

Alternative Name: CHN2

Background: CHN2 is a protein with a phorbol-ester/DAG-type zinc finger, a Rho-GAP domain and an SH2 domain. This protein has GTPase-activating protein activity that is regulated by phospholipid binding and binding of diacylglycerol (DAG) induces translocation of the protein from the cytosol to the Golgi apparatus membrane. CHN2 plays a role in the proliferation and migration of smooth muscle cells. Decreased expression of this gene is associated with high-grade gliomas and breast tumors, and increased expression of this gene is associated with lymphomas. Mutations in this gene have been associated with schizophrenia in men.

Molecular Weight: 38 kDa (MW of target protein)