HGD antibody

Catalog No. ABIN631446

The Rabbit Polyclonal anti-HGD antibody (ABIN631446) specifically detects HGD in WB. The antibody is reactive with Human samples.

Quick Overview for HGD antibody (ABIN631446)

Target: HGD (Homogentisate 1,2-Dioxygenase (HGD))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HGD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HGD Antibody

Purification: Affinity purified

Immunogen: HGD antibody was raised using a synthetic peptide corresponding to a region with amino acids KLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HGD Blocking Peptide, (ABIN939893), is also available for use as a blocking control in assays to test for specificity of this HGD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HGD

Target: HGD (Homogentisate 1,2-Dioxygenase (HGD))

Alternative Name: HGD

Background: Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver.

Molecular Weight: 50 kDa (MW of target protein)