LRRC6 antibody (Middle Region)

Catalog No. ABIN631479

The Rabbit Polyclonal anti-LRRC6 antibody (ABIN631479) specifically detects LRRC6 in WB. The antibody is reactive with Human samples.

Quick Overview for LRRC6 antibody (Middle Region) (ABIN631479)

Target: LRRC6 (Leucine Rich Repeat Containing 6 (LRRC6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRC6 Antibody

Binding Specificity: Middle Region

Specificity: LRRC6 antibody was raised against the middle region of LRRC6

Purification: Affinity purified

Immunogen: LRRC6 antibody was raised using the middle region of LRRC6 corresponding to a region with amino acids MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC6 Blocking Peptide, (ABIN5614585), is also available for use as a blocking control in assays to test for specificity of this LRRC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC6

Target: LRRC6 (Leucine Rich Repeat Containing 6 (LRRC6))

Alternative Name: LRRC6

Background: LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: M Phase