Hydroxyacid Oxidase 2 (HAO2) antibody

Catalog No. ABIN631486

This Rabbit Polyclonal antibody specifically detects Hydroxyacid Oxidase 2 in WB. It exhibits reactivity toward Human.

Quick Overview for Hydroxyacid Oxidase 2 (HAO2) antibody (ABIN631486)

Target: Hydroxyacid Oxidase 2 (HAO2)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Purification: Affinity purified

Immunogen: HAO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HAO2 Blocking Peptide, (ABIN937271), is also available for use as a blocking control in assays to test for specificity of this HAO2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Hydroxyacid Oxidase 2 (HAO2)

Alternative Name: HAO2

Background: HAO2 is one of three related proteins that have 2-hydroxyacid oxidase activity yet differ in amino acid sequence, tissue expression and substrate preference. Subcellular location of the protein is the peroxisome. Specifically, the protein is expressed predominantly in liver and kidney and has the highest activity toward the substrate 2-hydroxypalmitate. Two alternatively spliced variants encoding the same isoform have been described.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process