PCYT2 antibody (Middle Region)

Catalog No. ABIN631492

This Rabbit Polyclonal antibody specifically detects PCYT2 in WB. It exhibits reactivity toward Human.

Quick Overview for PCYT2 antibody (Middle Region) (ABIN631492)

Target: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCYT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCYT2 Antibody

Binding Specificity: Middle Region

Specificity: PCYT2 antibody was raised against the middle region of PCYT2

Purification: Affinity purified

Immunogen: PCYT2 antibody was raised using the middle region of PCYT2 corresponding to a region with amino acids KCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCYT2 Blocking Peptide, (ABIN939660), is also available for use as a blocking control in assays to test for specificity of this PCYT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCYT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCYT2

Target: PCYT2 (Phosphate Cytidylyltransferase 2, Ethanolamine (PCYT2))

Alternative Name: PCYT2

Background: PCYT2 is an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.

Molecular Weight: 44 kDa (MW of target protein)