SDSL antibody (Middle Region)

Catalog No. ABIN631495

This Rabbit Polyclonal antibody specifically detects SDSL in WB. It exhibits reactivity toward Human.

Quick Overview for SDSL antibody (Middle Region) (ABIN631495)

Target: SDSL (Serine Dehydratase-Like (SDSL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDSL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SDSL Antibody

Binding Specificity: Middle Region

Specificity: SDSL antibody was raised against the middle region of SDSL

Purification: Affinity purified

Immunogen: SDSL antibody was raised using the middle region of SDSL corresponding to a region with amino acids ALAAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDSL Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this SDSL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDSL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDSL

Target: SDSL (Serine Dehydratase-Like (SDSL))

Alternative Name: SDSL

Background: SDSL has low serine dehydratase and threonine dehydratase activity.

Molecular Weight: 35 kDa (MW of target protein)