Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Calicin (CCIN) antibody

Antigen

Calicin (CCIN)

Synonyms CCIN, MGC133688, Ccin, MGC94933, 4933417A14Rik
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631496
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name Calicin
Immunogen Calicin antibody was raised using the C terminal of CCIN corresponding to a region with amino acids TTSVPVLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNA
Description CCIN is a basic protein of the sperm head cytoskeleton. This protein contains kelch repeats and a BTB/POZ domain and is necessary for normal morphology during sperm differentiation.
Molecular Weight 65 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCIN antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Reproduction, Cytoskeleton, Microfilaments
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Calicin (CCIN)", type "Antibodies"
Hosts Guinea Pig (1)
Reactivities Cow (Bovine) (1), Human (1)
Applications Immunohistochemistry (Frozen Sections) (IHC (fro)) (1), Western Blotting (WB) (1)