Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Prostaglandin Reductase 2 (PTGR2) antibody

Antigen

Prostaglandin Reductase 2 (PTGR2)

Synonyms PGR2, ZADH1, FLJ39091, FLJ99229, DKFZp686P10120, Zadh1, MGC108784, MGC134348, MGC146252, DKFZp469L2120
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631563
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name ZADH1
Immunogen ZADH1 antibody was raised using the middle region of Zadh1 corresponding to a region with amino acids ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT
Description ZADH1 is an enzyme involved in the metabolism of prostaglandins. ZADH1 catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. ZADH1 may also be involved in regulating activation of the peroxisome proliferator-activated receptor.
Molecular Weight 38 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZADH1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Prostaglandin Reductase 2 (PTGR2)", type "Antibodies"
Hosts Mouse (1), Rabbit (1)
Reactivities Human (2)
Applications Western Blotting (WB) (2), ELISA (1), ELISA (Detection) (1)