Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

SCP2 antibody

Antigen

SCP2

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631588
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen SCP2 antibody was raised using the middle region of SCP2 corresponding to a region with amino acids NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA
Description SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.
Molecular Weight 35 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCP2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "SCP2", type "Antibodies"
Hosts Rabbit (3), Mouse (2)
Reactivities Human (5)
Applications Western Blotting (WB) (5), ELISA (4), Immunohistochemistry (IHC) (2)