SCP2 antibody (Middle Region)

Catalog No. ABIN631588

This Rabbit Polyclonal antibody specifically detects SCP2 in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for SCP2 antibody (Middle Region) (ABIN631588)

Target: SCP2 (Sterol Carrier Protein 2 (SCP2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SCP2 Antibody

Binding Specificity: Middle Region

Specificity: SCP2 antibody was raised against the middle region of SCP2

Purification: Affinity purified

Immunogen: SCP2 antibody was raised using the middle region of SCP2 corresponding to a region with amino acids NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCP2 Blocking Peptide, (ABIN5616017), is also available for use as a blocking control in assays to test for specificity of this SCP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCP2

Target: SCP2 (Sterol Carrier Protein 2 (SCP2))

Alternative Name: SCP2

Background: SCP2 protein is thought to be an intracellular lipid transfer protein. SCP2 is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process