Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

PDGFA Associated Protein 1 (PDAP1) antibody

Antigen

PDGFA Associated Protein 1 (PDAP1)

Synonyms PAP, PAP1, HASPP28, Haspp28, MGC56213, zgc:56213, PDAP1
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631613
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name PDAP1
Immunogen PDAP1 antibody was raised using the N terminal of PDAP1 corresponding to a region with amino acids MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD
Description PDAP1 enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.
Molecular Weight 20 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDAP1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling
Restrictions For Research Use only

Alternatives

Alternatives for antigen "PDGFA Associated Protein 1 (PDAP1)", type "Antibodies"
Hosts Rabbit (3), Mouse (1)
Reactivities Human (4)
Applications Western Blotting (WB) (4), Enzyme Immunoassay (EIA) (3), ELISA (1)
Epitopes C-Term (2)