Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Selenium Binding Protein 1 (SELENBP1) antibody

Antigen

Selenium Binding Protein 1 (SELENBP1)

Synonyms LPSB, SP56, hSBP, hSP56, FLJ13813, Lp56, Lpsb, SBP56, MGC18519, Selenbp2, MGC65844, zgc:65844, SELENBP1, hsbp, lpsb, sp56, sbp56, MGC82850, MGC129063, MGC115145, selenbp1-a, SBP, DKFZp469G1732
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631644
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name SELENBP1
Immunogen SELENBP1 antibody was raised using the C terminal of SELENBP1 corresponding to a region with amino acids KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR
Description SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.
Molecular Weight 44 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SELENBP1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Selenium Binding Protein 1 (SELENBP1)", type "Antibodies"
Hosts Rabbit (2)
Reactivities Human (1)
Applications Western Blotting (WB) (2), ELISA (1)