LCP1 antibody

Catalog No. ABIN631649

The Rabbit Polyclonal anti-LCP1 antibody is suitable to detect LCP1 in samples from Human. It has been validated for WB.

Quick Overview for LCP1 antibody (ABIN631649)

Target: LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LCP1 Antibody

Purification: Affinity purified

Immunogen: LCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LCP1 Blocking Peptide, (ABIN939428), is also available for use as a blocking control in assays to test for specificity of this LCP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCP1

Target: LCP1 (Lymphocyte Cytosolic Protein 1 (LCP1))

Alternative Name: LCP1

Background: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.).

Molecular Weight: 70 kDa (MW of target protein)