AKAP7 antibody

Catalog No. ABIN631655

The Rabbit Polyclonal anti-AKAP7 antibody is suitable to detect AKAP7 in samples from Human. It has been validated for WB.

Quick Overview for AKAP7 antibody (ABIN631655)

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKAP7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AKAP7 Antibody

Purification: Affinity purified

Immunogen: AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DERLAKAMVSDGSFHITLLVMQLLNEDEVNIGIDALLELKPFIEELLQGK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKAP7 Blocking Peptide, (ABIN937305), is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKAP7

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Alternative Name: AKAP7

Background: AKAP7 is a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.

Molecular Weight: 37 kDa (MW of target protein)