PES1 antibody

Catalog No. ABIN631680

The Rabbit Polyclonal anti-PES1 antibody (ABIN631680) specifically detects PES1 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for PES1 antibody (ABIN631680)

Target: PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PES1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PES1 Antibody

Purification: Affinity purified

Immunogen: PES1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PES1 Blocking Peptide, (ABIN939875), is also available for use as a blocking control in assays to test for specificity of this PES1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PES1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PES1

Target: PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))

Alternative Name: PES1

Background: PES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.

Molecular Weight: 68 kDa (MW of target protein)