APRT antibody (N-Term)

Catalog No. ABIN631682

The Rabbit Polyclonal anti-APRT antibody is suitable to detect APRT in samples from Human. It has been validated for WB.

Quick Overview for APRT antibody (N-Term) (ABIN631682)

Target: APRT (Adenine Phosphoribosyltransferase (APRT))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APRT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APRT Antibody

Binding Specificity: N-Term

Specificity: APRT antibody was raised against the N terminal of APRT

Purification: Affinity purified

Immunogen: APRT antibody was raised using the N terminal of APRT corresponding to a region with amino acids ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APRT Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this APRT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APRT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APRT

Target: APRT (Adenine Phosphoribosyltransferase (APRT))

Alternative Name: APRT

Background: Adenine phosphoribosyltransferase (APRT) belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process