C22orf9 antibody (Middle Region)

Catalog No. ABIN631718

The Rabbit Polyclonal anti-C22orf9 antibody is suitable to detect C22orf9 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for C22orf9 antibody (Middle Region) (ABIN631718)

Target: C22orf9 (Chromosome 22 Open Reading Frame 9 (C22orf9))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C22orf9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C22orf9 Antibody

Binding Specificity: Middle Region

Specificity: C22 ORF9 antibody was raised against the middle region of C22 rf9

Purification: Affinity purified

Immunogen: C22 ORF9 antibody was raised using the middle region of C22 rf9 corresponding to a region with amino acids ERVTSFSTPPTPERNNRPAFFSPSLKRKVPRNRIAEMKKSHSANDSEEFF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C22ORF9 Blocking Peptide, (ABIN938103), is also available for use as a blocking control in assays to test for specificity of this C22ORF9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C22orf9

Target: C22orf9 (Chromosome 22 Open Reading Frame 9 (C22orf9))

Alternative Name: C22ORF9

Background: The function of C22orf9 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 46 kDa (MW of target protein)