FLJ25791 (Middle Region) antibody

Catalog No. ABIN631722

The Rabbit Polyclonal anti-FLJ25791 antibody (ABIN631722) specifically detects FLJ25791 in WB. The antibody is reactive with Human samples.

Quick Overview for FLJ25791 (Middle Region) antibody (ABIN631722)

Target: FLJ25791

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: FLJ25791 antibody was raised against the middle region of Flj25791

Purification: Affinity purified

Immunogen: FLJ25791 antibody was raised using the middle region of Flj25791 corresponding to a region with amino acids EYTRKKYKKKMEQFMESCELITYLGAKMTRKYKEPQFRAIDFDHKLKTFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ25791 Blocking Peptide, (ABIN938217), is also available for use as a blocking control in assays to test for specificity of this FLJ25791 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ25791 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: FLJ25791

Background: FLJ25791 is believed to be involved in nucleotide kinase activity and nucleotide binding

Molecular Weight: 36 kDa (MW of target protein)