ICEF1 antibody (Middle Region)

Catalog No. ABIN631757

The Rabbit Polyclonal anti-ICEF1 antibody is suitable to detect ICEF1 in samples from Human. It has been validated for WB.

Quick Overview for ICEF1 antibody (Middle Region) (ABIN631757)

Target: ICEF1 (IPCEF1) (Interaction Protein For Cytohesin Exchange Factors 1 (IPCEF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ICEF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ICEF1 Antibody

Binding Specificity: Middle Region

Specificity: PIP3-E antibody was raised against the middle region of PIP3-E

Purification: Affinity purified

Immunogen: PIP3-E antibody was raised using the middle region of PIP3-E corresponding to a region with amino acids IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIP3-E Blocking Peptide, (ABIN939368), is also available for use as a blocking control in assays to test for specificity of this PIP3-E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP3-E antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ICEF1

Target: ICEF1 (IPCEF1) (Interaction Protein For Cytohesin Exchange Factors 1 (IPCEF1))

Alternative Name: PIP3-E

Background: PIP3-E enhances the promotion of guanine-nucleotide exchange by PSCD2 on ARF6 in a concentration-dependent manner.

Molecular Weight: 49 kDa (MW of target protein)