Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

EIF5 antibody

Antigen

EIF5
Clonality Polyclonal
Host
Alternatives

Rabbit
Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631763
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information
Application Details Alternatives Secondary Antibodies back to top

Immunogen EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPT
Description EIF5 catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex.
Molecular Weight 49 kDa (MW of target protein)

Application Details
Alternatives Secondary Antibodies back to top

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF5 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only

Alternatives
Application Details Secondary Antibodies back to top

Alternatives for antigen "EIF5", type "Antibodies"
Hosts Rabbit (22), Mouse (4)
Reactivities Human (25), Mouse (Murine) (20), Rat (Rattus) (20), Rabbit (15)
Applications Immunofluorescence (IF) (21), Flow Cytometry (FACS) (18), Western Blotting (WB) (9), ELISA (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Enzyme Immunoassay (EIA) (2), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoprecipitation (IP) (2), ELISA (Detection) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)