Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
HB antibody
| Antigen | HB |
| Clonality | Polyclonal |
| Host |
Rabbit |
| Application |
Western Blotting (WB)
|
| Catalog no. | ABIN631771 |
| Quantity | 50 ug (1 mg/ml) |
| Price | 478.33 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Immunogen | HB antibody was raised using the N terminal Of Hb corresponding to a region with amino acids MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP |
| Description | Hb is a gap class segmentation protein that controls development of head structures. |
| Molecular Weight | 83 kDa (MW of target protein) |
Application Details
| Concentration | 1 mg/ml |
| Purification | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HB antibody in PBS |
| Storage | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
| Restrictions | For Research Use only |
