CAD antibody (Middle Region)

Catalog No. ABIN631789

This Rabbit Polyclonal antibody specifically detects CAD in WB. It exhibits reactivity toward Drosophila melanogaster.

Quick Overview for CAD antibody (Middle Region) (ABIN631789)

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Reactivity: Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CAD Antibody

Binding Specificity: Middle Region

Specificity: CAD antibody was raised against the middle region of CAD

Purification: Affinity purified

Immunogen: CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAD Blocking Peptide, (ABIN5612572), is also available for use as a blocking control in assays to test for specificity of this CAD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAD

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Alternative Name: CAD

Background: Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg).

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process