HIPK4 antibody (Middle Region)

Catalog No. ABIN631807

This Rabbit Polyclonal antibody specifically detects HIPK4 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for HIPK4 antibody (Middle Region) (ABIN631807)

Target: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HIPK4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HIPK4 Antibody

Binding Specificity: Middle Region

Specificity: HIPK4 antibody was raised against the middle region of HIPK4

Purification: Affinity purified

Immunogen: HIPK4 antibody was raised using the middle region of HIPK4 corresponding to a region with amino acids AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HIPK4 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HIPK4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HIPK4

Target: HIPK4 (Homeodomain Interacting Protein Kinase 4 (HIPK4))

Alternative Name: HIPK4

Background: HIPK4 is a protein kinase that phosphorylates human TP53 at Ser-9, and thus induces TP53 repression of BIRC5 promoter. It may act as a corepressor of transcription factors.

Molecular Weight: 69 kDa (MW of target protein)