PHYHIP antibody (N-Term)

Catalog No. ABIN631821

The Rabbit Polyclonal anti-PHYHIP antibody (ABIN631821) specifically detects PHYHIP in WB. The antibody is reactive with Human, Mouse, Rat and Dog samples.

Quick Overview for PHYHIP antibody (N-Term) (ABIN631821)

Target: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHYHIP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PHYHIP Antibody

Binding Specificity: N-Term

Specificity: PHYHIP antibody was raised against the N terminal of PHYHIP

Purification: Affinity purified

Immunogen: PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHYHIP Blocking Peptide, (ABIN939757), is also available for use as a blocking control in assays to test for specificity of this PHYHIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYHIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHYHIP

Target: PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))

Alternative Name: PHYHIP

Background: PHYHIP interacts with PHYH suggests a role in the development of the central system.

Molecular Weight: 38 kDa (MW of target protein)