Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

F-Box and WD Repeat Domain Containing 10 (FBXW10) antibody

Antigen

F-Box and WD Repeat Domain Containing 10 (FBXW10)

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN631824
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name FBXW10
Immunogen FBXW10 antibody was raised using the middle region of FBXW10 corresponding to a region with amino acids RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD
Description Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
Molecular Weight 120 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXW10 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "F-Box and WD Repeat Domain Containing 10 (FBXW10)", type "Antibodies"
Hosts Rabbit (3)
Reactivities Human (2)
Applications Western Blotting (WB) (3), ELISA (2)