TBCK antibody (Middle Region)

Catalog No. ABIN631832

The Rabbit Polyclonal anti-TBCK antibody is suitable to detect TBCK in samples from Human. It has been validated for WB.

Quick Overview for TBCK antibody (Middle Region) (ABIN631832)

Target: TBCK (TBC1 Domain Containing Kinase (TBCK))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBCK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TBCK Antibody

Binding Specificity: Middle Region

Specificity: MGC16169 antibody was raised against the middle region of Mgc16169

Purification: Affinity purified

Immunogen: MGC16169 antibody was raised using the middle region of Mgc16169 corresponding to a region with amino acids PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC16169 Blocking Peptide, (ABIN5614743), is also available for use as a blocking control in assays to test for specificity of this MGC16169 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC16169 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBCK

Target: TBCK (TBC1 Domain Containing Kinase (TBCK))

Background: The function of MGC16169 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 94 kDa (MW of target protein)