ALS2CR12 antibody

Catalog No. ABIN631852

This Rabbit Polyclonal antibody specifically detects ALS2CR12 in WB. It exhibits reactivity toward Human.

Quick Overview for ALS2CR12 antibody (ABIN631852)

Target: ALS2CR12 (Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALS2CR12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALS2CR12 Antibody

Purification: Affinity purified

Immunogen: ALS2 CR12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALS2CR12 Blocking Peptide, (ABIN5612041), is also available for use as a blocking control in assays to test for specificity of this ALS2CR12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALS0 R12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALS2CR12

Target: ALS2CR12 (Amyotrophic Lateral Sclerosis 2 (Juvenile) Chromosome Region, Candidate 12 (ALS2CR12))

Alternative Name: ALS2CR12

Background: The function of ALS2CR12 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 52 kDa (MW of target protein)