APOBEC4 antibody

Catalog No. ABIN631877

The Rabbit Polyclonal anti-APOBEC4 antibody is suitable to detect APOBEC4 in samples from Human. It has been validated for WB.

Quick Overview for APOBEC4 antibody (ABIN631877)

Target: APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOBEC4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APOBEC4 Antibody

Purification: Affinity purified

Immunogen: ApoBEC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoBEC4 Blocking Peptide, (ABIN940496), is also available for use as a blocking control in assays to test for specificity of this ApoBEC4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOBEC4

Target: APOBEC4 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 4 (Putative) (APOBEC4))

Alternative Name: ApoBEC4

Background: APOBEC4 is a putative C to U editing enzyme whose physiological substrate is not yet known.

Molecular Weight: 41 kDa (MW of target protein)