C21orf91 antibody (Middle Region)

Catalog No. ABIN631903

This Rabbit Polyclonal antibody specifically detects C21orf91 in WB. It exhibits reactivity toward Human.

Quick Overview for C21orf91 antibody (Middle Region) (ABIN631903)

Target: C21orf91 (Chromosome 21 Open Reading Frame 91 (C21orf91))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C21orf91 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C21orf91 Antibody

Binding Specificity: Middle Region

Specificity: C21 ORF91 antibody was raised against the middle region of C21 rf91

Purification: Affinity purified

Immunogen: C21 ORF91 antibody was raised using the middle region of C21 rf91 corresponding to a region with amino acids LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C21ORF91 Blocking Peptide, (ABIN940216), is also available for use as a blocking control in assays to test for specificity of this C21ORF91 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF91 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C21orf91

Target: C21orf91 (Chromosome 21 Open Reading Frame 91 (C21orf91))

Alternative Name: C21ORF91

Background: The function of C21orf91 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 34 kDa (MW of target protein)