GABARAPL2 antibody

Catalog No. ABIN631966

This Rabbit Polyclonal antibody specifically detects GABARAPL2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GABARAPL2 antibody (ABIN631966)

Target: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABARAPL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GABARAPL2 Antibody

Purification: Affinity purified

Immunogen: GABARAPL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABARAPL2 Blocking Peptide, (ABIN940117), is also available for use as a blocking control in assays to test for specificity of this GABARAPL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABARAPL2

Target: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Alternative Name: GABARAPL2

Background: GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Autophagy