MRGBP antibody (Middle Region)

Catalog No. ABIN631994

The Rabbit Polyclonal anti-MRGBP antibody is suitable to detect MRGBP in samples from Human. It has been validated for WB.

Quick Overview for MRGBP antibody (Middle Region) (ABIN631994)

Target: MRGBP (MRG-Binding Protein (MRGBP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRGBP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MRGBP Antibody

Binding Specificity: Middle Region

Specificity: C20 ORF20 antibody was raised against the middle region of C20 rf20

Purification: Affinity purified

Immunogen: C20 ORF20 antibody was raised using the middle region of C20 rf20 corresponding to a region with amino acids LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEM

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF20 Blocking Peptide, (ABIN5612482), is also available for use as a blocking control in assays to test for specificity of this C20ORF20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRGBP

Target: MRGBP (MRG-Binding Protein (MRGBP))

Alternative Name: C20ORF20

Background: C20orf20 belongs to the EAF7 family. It is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.

Molecular Weight: 22 kDa (MW of target protein)