TCP11 antibody

Catalog No. ABIN632031

The Rabbit Polyclonal anti-TCP11 antibody (ABIN632031) specifically detects TCP11 in WB. The antibody is reactive with Human samples.

Quick Overview for TCP11 antibody (ABIN632031)

Target: TCP11 (T-Complex 11, Testis-Specific (TCP11))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCP11 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TCP11 Antibody

Purification: Affinity purified

Immunogen: TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCP11 Blocking Peptide, (ABIN937464), is also available for use as a blocking control in assays to test for specificity of this TCP11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCP11

Target: TCP11 (T-Complex 11, Testis-Specific (TCP11))

Alternative Name: TCP11

Background: TCP11 may play an important role in sperm function and fertility.

Molecular Weight: 49 kDa (MW of target protein)