Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ALDH1L1 antibody

Antigen

ALDH1L1

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN632033
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen ALDH1L1 antibody was raised using the middle region of ALDH1L1 corresponding to a region with amino acids LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS
Description ALDH1L1 catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. ALDH1L1 belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning.
Molecular Weight 99 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ALDH1L1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Cancer, Cell Cycle, Metabolism, Apoptosis/Necrosis, Glia marker
Restrictions For Research Use only

Alternatives

Alternatives for antigen "ALDH1L1", type "Antibodies"
Hosts Rabbit (21), Mouse (14)
Reactivities Rat (Rattus) (19), Mouse (Murine) (18), Human (9), Dog (Canine) (3), Cow (Bovine) (2), Horse (Equine) (2), Pig (Porcine) (2), Monkey (1), Rabbit (1), Sheep (Ovine) (1)
Applications Immunofluorescence (IF) (27), Flow Cytometry (FACS) (26), Western Blotting (WB) (18), ELISA (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (IHC) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)