Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ASPA antibody

Antigen

ASPA

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN632065
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen ASPA antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADIL
Description ASPA catalyzes the deacetylation of N-acetylaspartic acid (NAA) to produce acetate and L-aspartate. NAA occurs in high concentration in brain and its hydrolysis NAA plays a significant part in the maintenance of intact white matter. In other tissues it acts as a scavenger of NAA from body fluids.
Molecular Weight 36 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASPA antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Neurology, Metabolism, Amino Acids
Restrictions For Research Use only

Alternatives

Alternatives for antigen "ASPA", type "Antibodies"
Hosts Mouse (1), Rabbit (1)
Reactivities Human (1)
Applications Western Blotting (WB) (2), ELISA (1)