PLS1 antibody

Catalog No. ABIN632072

The Rabbit Polyclonal anti-PLS1 antibody is suitable to detect PLS1 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for PLS1 antibody (ABIN632072)

Target: PLS1 (Plastin 1 (PLS1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLS1 Antibody

Purification: Affinity purified

Immunogen: Plastin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Plastin 1 Blocking Peptide, (ABIN939538), is also available for use as a blocking control in assays to test for specificity of this Plastin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLS1

Target: PLS1 (Plastin 1 (PLS1))

Alternative Name: Plastin 1

Background: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.

Molecular Weight: 70 kDa (MW of target protein)